PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009600309.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 324aa    MW: 37434.9 Da    PI: 5.0572
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009600309.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM71.42.4e-22121383128
             NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykv.ePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     +G rFhPt+ e++ ++Lk+ ++g++l+ e  ++++diy    Pw++     ++eek  yfF++ +k++++ +r +r+ ++g+Wka+    ++++ 
  XP_009600309.1  12 MGKRFHPTEGEMI-NFLKRFLKGETLPSEYRFQHADIYGDrPPWEIFgVDSNSEEKVGYFFTQLKKQKSEHTRVHRTCANGTWKAQTGIVPIKNG 105
                     699**********.9***********99778*******87478***734555555566***************************9999*****9 PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     kg +vg ++ + f   ++++ ++  W+m+ey +
  XP_009600309.1 106 KGIVVGFRRNFKFQCSSKEREHNKIWLMKEYYV 138
                     **************99999999*********75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100524.99810161IPR003441NAC domain
SuperFamilySSF1019419.29E-2611160IPR003441NAC domain
PfamPF023651.7E-1213137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MSTVPAARRR IMGKRFHPTE GEMINFLKRF LKGETLPSEY RFQHADIYGD RPPWEIFGVD  60
SNSEEKVGYF FTQLKKQKSE HTRVHRTCAN GTWKAQTGIV PIKNGKGIVV GFRRNFKFQC  120
SSKEREHNKI WLMKEYYVGD DFFGENNIPK EDIVVCRIKK NIREKKVKDD AVSMDEQELA  180
QIIEAMLHGP DEYNCILQPA AVCQGNETHN EFIENTMLHA EYAPNHYLSG PNYQNSQLLI  240
NSDEGNQVTI WGNQNNMMAM LTEDATTNLT TLEQEAYDQL LTAEIEQGHG ADHQTNNDSE  300
FWEAMKGILE DVNFFVPEDW QNDP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU7532580.0EU753258.1 Nicotiana tabacum NAC transcription factor (NAC1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009600309.10.0PREDICTED: NAC domain-containing protein 76-like
TrEMBLB3VK701e-151B3VK70_TOBAC; NAC transcription factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8141386
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.16e-14NAC domain containing protein 2